Antibodies

Jump to Filters
View as table Download
NPAS4 Rabbit Polyclonal Antibody
TA316290

USD 345.00

In Stock

Rabbit polyclonal anti-NPAS4 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPAS4.
NPAS4 Rabbit Polyclonal Antibody
TA590360

USD 409.00

In Stock

Rabbit Polyclonal Npas4 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
NPAS4 Rabbit Polyclonal Antibody
TA330603

USD 375.00

5 Days

Rabbit Polyclonal Anti-NPAS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPAS4 antibody: synthetic peptide directed towards the middle region of human NPAS4. Synthetic peptide located within the following region: QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTL