Antibodies

Jump to Filters
View as table Download
GCNF (NR6A1) (N-term) Rabbit Polyclonal Antibody
AP52935PU-N

USD 450.00

2 Weeks

GCNF (NR6A1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 37-67 amino acids from the N-terminal region of human NR6A1
GCNF (NR6A1) Rabbit Polyclonal Antibody
TA330602

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR6A1 antibody: synthetic peptide directed towards the N terminal of human NR6A1. Synthetic peptide located within the following region: FCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLHYGIISCEGCKGFF
GCNF (NR6A1) Rabbit Polyclonal Antibody
TA356563

USD 360.00

5 Days

NR6A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR6A1
GCNF (NR6A1) Rabbit Polyclonal Antibody
TA356564

USD 360.00

5 Days

NR6A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NR6A1