Rabbit Polyclonal TrkC Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288]. |
Rabbit Polyclonal TrkC Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288]. |
Rabbit anti-NTRK3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTRK3 |
Rabbit polyclonal TrkC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TrkC antibody is generated from rabbits immunized with a his tag recombinant protein of human TrkC. |
Rabbit Polyclonal Anti-NTRK3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |