Antibodies

Jump to Filters
View as table Download
PEPD Rabbit Polyclonal Antibody
TA332680

USD 275.00

3 Weeks

Rabbit anti-PEPD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PEPD
PEPD Rabbit Polyclonal Antibody
TA335138

USD 375.00

5 Days

Rabbit polyclonal Anti-PEPD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEPD antibody: synthetic peptide directed towards the middle region of human PEPD. Synthetic peptide located within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV