Antibodies

View as table Download

PERP Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PERP antibody was raised against synthetic peptide from human PERP.

Rabbit Polyclonal PERP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PERP antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human PERP, which differ from the mouse sequence by three amino acids (7-9) .

Rabbit Polyclonal Anti-PERP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP. Synthetic peptide located within the following region: FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG