Rabbit Polyclonal Anti-TXLNA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXLNA antibody is: synthetic peptide directed towards the C-terminal region of Human TXLNA. Synthetic peptide located within the following region: LTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSAR |
Rabbit Polyclonal Anti-TXLNA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXLNA antibody is: synthetic peptide directed towards the N-terminal region of Human TXLNA. Synthetic peptide located within the following region: APRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGA |
Germany
Japan
United Kingdom
China
