Antibodies

Jump to Filters
View as table Download
UROD Rabbit Polyclonal Antibody
TA346183

USD 410.00

5 Days

Rabbit Polyclonal Anti-UROD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UROD antibody: synthetic peptide directed towards the N terminal of human UROD. Synthetic peptide located within the following region: SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV
UROD Rabbit Polyclonal Antibody
TA332724

USD 275.00

3 Weeks

Rabbit anti-UROD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human UROD