Antibodies

View as table Download

Rabbit polyclonal anti-SUCNR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SUCNR1.

GPR91 (SUCNR1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 102-154 of Human GPR91.

Rabbit Polyclonal Anti-SUCNR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1

Rabbit Polyclonal Anti-SUCNR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUCNR1 antibody is: synthetic peptide directed towards the middle region of Human SUCNR1. Synthetic peptide located within the following region: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI

Rabbit Polyclonal Anti-SUCNR1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen SUCNR1 / GPR91 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR91. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Dog, Bovine, Panda, Horse (88%).

Rabbit Polyclonal Anti-SUCNR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SUCNR1 / GPR91 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR91. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gorilla, Gibbon, Marmoset (94%).