NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A. |
NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A. |
NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Anti-NMDA NR2A Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2A Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GRIN2A |
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |