Antibodies

Jump to Filters
View as table Download
BRD4 Rabbit Polyclonal Antibody
TA343731

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-BRD4 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
BRD4 Rabbit Polyclonal Antibody
TA350939

USD 345.00

In Stock

Rabbit Polyclonal Anti-BRD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRD4