Antibodies

Jump to Filters
View as table Download
SERPINB4 Rabbit Polyclonal Antibody
TA346336

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERPINB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB4 antibody: synthetic peptide directed towards the N terminal of human SERPINB4. Synthetic peptide located within the following region: TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ
SERPINB4 Rabbit Polyclonal Antibody
TA590667

USD 409.00

In Stock

Rabbit Polyclonal SERPINB4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
SERPINB4 Rabbit Polyclonal Antibody
TA313038

USD 345.00

In Stock

Rabbit polyclonal anti-SERPINB4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SERPINB4.
SERPINB4 (C-term) Rabbit Polyclonal Antibody
AP54006PU-N

USD 450.00

2 Weeks

SERPINB4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 275-304aa) of human SERPINB4 / SCCA2