Antibodies

Jump to Filters
View as table Download
COPS6 Rabbit Polyclonal Antibody
TA342587

USD 375.00

5 Days

Rabbit Polyclonal Anti-COPS6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COPS6 antibody: synthetic peptide directed towards the middle region of human COPS6. Synthetic peptide located within the following region: DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV