Antibodies

View as table Download

Rabbit Polyclonal Anti-BCL11A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the N terminal of human BCL11A. Synthetic peptide located within the following region: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ

Rabbit Polyclonal Anti-BCL11A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the C terminal of human BCL11A. Synthetic peptide located within the following region: YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR

Rabbit anti-BCL11A Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCL11A

Rabbit Polyclonal Ctip1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

CTIP1 (BCL11A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 806~835 amino acids from the C-terminal region of human BCL11A