Antibodies

Jump to Filters
View as table Download
MEF2D (N-term) Rabbit Polyclonal Antibody
AP52662PU-N

USD 450.00

2 Weeks

MEF2D (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 115-144 amino acids from the N-terminal region of human MEF2D
MEF2D Rabbit Polyclonal Antibody
TA343568

USD 375.00

5 Days

Rabbit Polyclonal Anti-MEF2D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MEF2D antibody: synthetic peptide directed towards the middle region of human MEF2D. Synthetic peptide located within the following region: GDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLD