PHF20 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 130-159 amino acids from the N-terminal region of human PHF20 |
PHF20 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 130-159 amino acids from the N-terminal region of human PHF20 |
Rabbit Polyclonal Anti-PHF20 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHF20 antibody: synthetic peptide directed towards the C terminal of human PHF20. Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS |