Rabbit Polyclonal Anti-ADAM12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE |
Rabbit polyclonal anti-ADAM12 antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM12 |
Anti-ADAM12 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12 |
Germany
Japan
United Kingdom
China