Antibodies

Jump to Filters
View as table Download
MAVS Rabbit Polyclonal Antibody
TA306399

USD 430.00

2 Weeks

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA.
MAVS Rabbit Polyclonal Antibody
TA332896

USD 275.00

3 Weeks

Rabbit anti-MAVS Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAVS
MAVS Rabbit Polyclonal Antibody
TA338436

USD 375.00

In Stock

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ
MAVS Rabbit Polyclonal Antibody
TA306400

USD 430.00

5 Days

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA.
MAVS Rabbit Polyclonal Antibody
TA338435

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAVS Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH
MAVS Rabbit Polyclonal Antibody
TA351386

USD 345.00

In Stock

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS