Antibodies

View as table Download

Rabbit polyclonal anti-MTLR antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MTLR.

Motilin receptor (MLNR) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 364-394 amino acids from the C-terminal region of Human Motilin receptor.

Rabbit Polyclonal Anti-MLNR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLNR antibody is: synthetic peptide directed towards the C-terminal region of Human MLNR. Synthetic peptide located within the following region: ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD

Rabbit Polyclonal Anti-MLNR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MLNR/GPR38/Motilin Receptor antibody was raised against synthetic 16 amino acid peptide from C-terminal cytoplasmic domain of human MLNR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Marmoset (81%).

Rabbit Polyclonal Anti-MLNR Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MLNR