Antibodies

Jump to Filters
View as table Download
SIGLEC9 (C-term) Rabbit Polyclonal Antibody
AP11634PU-N

USD 450.00

2 Weeks

SIGLEC9 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 385-415 amino acids from the C-terminal region of human SIGLEC9.
SIGLEC9 Rabbit Polyclonal Antibody
TA308435

USD 415.00

5 Days

Rabbit polyclonal antibody to SIGLEC9 (sialic acid binding Ig-like lectin 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 273 of SIGLEC9 (Uniprot ID#Q9Y336)
SIGLEC9 Rabbit Polyclonal Antibody
TA341937

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA
SIGLEC9 Rabbit Polyclonal Antibody
TA349776

USD 345.00

In Stock

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SIGLEC9