Antibodies

Jump to Filters
View as table Download
ULBP1 Rabbit Polyclonal Antibody
TA339549

USD 375.00

5 Days

Rabbit Polyclonal Anti-ULBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ULBP1 antibody: synthetic peptide directed towards the N terminal of human ULBP1. Synthetic peptide located within the following region: MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC
ULBP1 Rabbit Polyclonal Antibody
TA351903

USD 345.00

In Stock

Rabbit Polyclonal Anti-ULBP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ULBP1