Rabbit polyclonal anti-ABCB7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB7. |
Rabbit polyclonal anti-ABCB7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB7. |
Rabbit Polyclonal Anti-ABCB7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB7 Antibody is: synthetic peptide directed towards the C-terminal region of Human ABCB7. Synthetic peptide located within the following region: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG |
Rabbit Polyclonal Anti-ABCB7 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ABCB7 |
ABCB7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ABCB7 |
ABCB7 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 503-753 of human ABCB7 (NP_004290.2). |
Modifications | Unmodified |