Antibodies

View as table Download

Rabbit anti-ACTR2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTR2

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR2 antibody: synthetic peptide directed towards the N terminal of human ACTR2. Synthetic peptide located within the following region: NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR2 antibody: synthetic peptide directed towards the middle region of human ACTR2. Synthetic peptide located within the following region: RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTR2

ACTR2 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTR2