Antibodies

View as table Download

Rabbit polyclonal anti-AMPD2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AMPD2.

Rabbit Polyclonal Anti-AMPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human AMPD2. Synthetic peptide located within the following region: VVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSA

AMPD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 657-798 of human AMPD2 (NP_631895.1).