Antibodies

Jump to Filters
View as table Download
BOULE (BOLL) Rabbit Polyclonal Antibody
TA343958

USD 475.00

5 Days

Rabbit Polyclonal Anti-BOLL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BOLL antibody: synthetic peptide directed towards the N terminal of human BOLL. Synthetic peptide located within the following region: GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
BOULE (BOLL) Rabbit Polyclonal Antibody
TA322123

USD 345.00

In Stock

Anti-BOLL Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein