Antibodies

Jump to Filters
View as table Download
CKLF Rabbit Polyclonal Antibody
TA342541

USD 375.00

5 Days

Rabbit Polyclonal Anti-CKLF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKLF antibody: synthetic peptide directed towards the N terminal of human CKLF. Synthetic peptide located within the following region: MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG
CKLF Rabbit Polyclonal Antibody
TA374824

USD 220.00

3 Weeks

CKLF Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1).
Modifications Unmodified