Antibodies

Jump to Filters
View as table Download
DPP10 Rabbit Polyclonal Antibody
TA335318

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
DPP10 Rabbit Polyclonal Antibody
TA375594

USD 220.00

3 Weeks

DPP10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1).
Modifications Unmodified