Antibodies

View as table Download

DUSP5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DUSP5

Rabbit Polyclonal Anti-DUSP5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID

Rabbit Polyclonal Anti-DUSP5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS

DUSP5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DUSP5

DUSP5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 315-384 of human DUSP5 (NP_004410.3).
Modifications Unmodified