Rabbit Polyclonal Anti-ELMO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELMO1 antibody: synthetic peptide directed towards the C terminal of human ELMO1. Synthetic peptide located within the following region: TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT |
ELMO1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ELMO1 |
ELMO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 527-727 of human ELMO1 (NP_055615.8). |
| Modifications | Unmodified |
ELMO1 Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
