Antibodies

View as table Download

GABPB1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABPB1

Rabbit Polyclonal Anti-GABPB2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the N terminal of human GABPB2. Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH

Rabbit Polyclonal antibody to GABPB1 (GA binding protein transcription factor, beta subunit 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 395 of GABPB1 (Uniprot ID#Q06547)

Rabbit Polyclonal Anti-GABPB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: PDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQ

Rabbit Polyclonal anti-GABPB2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the middle region of human GABPB2. Synthetic peptide located within the following region: EPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQ

Rabbit Polyclonal Anti-GABPB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: EEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEA

Rabbit Polyclonal Anti-GABPB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: PDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQ

Rabbit Polyclonal Anti-GABPB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GABPB2

GABPB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GABPB1

GABPB1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABPB1

GABPB1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GABPB1

GABPB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 231-395 of human GABPB1 (NP_005245.2).
Modifications Unmodified