Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal TIM-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TIM-1 antibody was raised against a 16 amino acid peptide from near the center of human TIM-1. |
Rabbit Polyclonal Anti-HAVCR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAVCR1 antibody: synthetic peptide directed towards the N terminal of human HAVCR1. Synthetic peptide located within the following region: CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR |
Anti-HAVCR1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 72-89 amino acids of Human hepatitis A virus cellular receptor 1 |
HAVCR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-120 of human HAVCR1 (NP_036338.2). |
| Modifications | Unmodified |
Hepatitis A Virus Cellular Receptor 1 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HAVCR1
Antibody Hosts
- Rabbit
Isotypes
- IgG