Antibodies

Jump to Filters
View as table Download
IMP3 Rabbit Polyclonal Antibody
TA343876

USD 475.00

5 Days

Rabbit Polyclonal Anti-IMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IMP3 antibody: synthetic peptide directed towards the middle region of human IMP3. Synthetic peptide located within the following region: GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
IMP3 Rabbit Polyclonal Antibody
TA377493

USD 220.00

3 Weeks

IMP3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human IMP3 (NP_060755.1).
Modifications Unmodified