Antibodies

View as table Download

Rabbit Polyclonal Anti-LMAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMAN1 antibody: synthetic peptide directed towards the N terminal of human LMAN1. Synthetic peptide located within the following region: DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS

Rabbit Polyclonal Anti-LMAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMAN1 antibody: synthetic peptide directed towards the middle region of human LMAN1. Synthetic peptide located within the following region: DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR

LMAN1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-480 of human LMAN1 (NP_005561.1).
Modifications Unmodified