P2RY4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human P2RY4 |
TA371772 is a possible alternative to TA321501.
P2RY4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human P2RY4 |
Anti-P2RY4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 349-364 amino acids of human pyrimidinergic receptor P2Y, G-protein coupled, 4 |
Rabbit polyclonal anti-P2RY4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY4. |
Rabbit Polyclonal Anti-P2RY4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-P2RY4 Antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY4. Synthetic peptide located within the following region: VTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVS |
P2RY4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human P2RY4 |