Antibodies

Jump to Filters
View as table Download
Prostaglandin F2 alpha Receptor (PTGFR) Rabbit Polyclonal Antibody
TA338356

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTGFR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGFR antibody is: synthetic peptide directed towards the C-terminal region of Human PTGFR. Synthetic peptide located within the following region: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV
Prostaglandin F2 alpha Receptor (PTGFR) Rabbit Polyclonal Antibody
TA380503

USD 220.00

3 Weeks

PTGFR Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PTGFR (NP_000950.1).
Modifications Unmodified