Antibodies

Jump to Filters
View as table Download
RAB14 Rabbit Polyclonal Antibody
TA330015

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB14 Antibody

Applications IHC, WB
Reactivities Human, Murin
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
RAB14 Rabbit Polyclonal Antibody
TA351570

USD 345.00

In Stock

Rabbit Polyclonal Anti-RAB14 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB14
RAB14 Rabbit Polyclonal Antibody
TA380610

USD 220.00

3 Weeks

RAB14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 126-215 of human RAB14 (NP_057406.2).
Modifications Unmodified