Antibodies

Jump to Filters
View as table Download
Rad9 (RAD9A) Rabbit Polyclonal Antibody
TA308749

USD 415.00

5 Days

Rabbit polyclonal antibody to Rad9 (RAD9 homolog A (S. pombe))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 197 and 391 of Rad9
Rad9 (RAD9A) Rabbit Polyclonal Antibody
TA301769

USD 363.00

5 Days

Rabbit Polyclonal Antibody against RAD9

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of full length human Rad9 protein
Rad9 (RAD9A) Rabbit Polyclonal Antibody
TA324191

USD 345.00

4 Weeks

Anti-RAD9A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human RAD9 homolog A (S. pombe)
Rad9 (RAD9A) Rabbit Polyclonal Antibody
TA330361

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAD9A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD9A antibody: synthetic peptide directed towards the C terminal of human RAD9A. Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS
Rad9 (RAD9A) Rabbit Polyclonal Antibody
TA380677

USD 220.00

3 Weeks

RAD9A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 162-391 of human RAD9A (NP_004575.1).
Modifications Unmodified