Antibodies

Jump to Filters
View as table Download
RNF149 Rabbit Polyclonal Antibody
TA330526

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF149 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RNF149 antibody is: synthetic peptide directed towards the C-terminal region of Human RNF149. Synthetic peptide located within the following region: LLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL
RNF149 Rabbit Polyclonal Antibody
TA380979

USD 220.00

3 Weeks

RNF149 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 221-400 of human RNF149 (NP_775918.2).