Rabbit polyclonal anti-SLC30A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A1. |
Rabbit polyclonal anti-SLC30A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A1. |
Rabbit Polyclonal Anti-SLC30A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC30A1 Antibody: synthetic peptide directed towards the middle region of human SLC30A1. Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY |
SLC30A1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC30A1 (NP_067017.2). |
Modifications | Unmodified |
SLC30A1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 328-507 of human SLC30A1 (NP_067017.2). |
Modifications | Unmodified |
SLC30A1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC30A1 (NP_067017.2). |
Modifications | Unmodified |