Rabbit polyclonal SORBS1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1. |
Rabbit Polyclonal Anti-Sorbs1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC |
Germany
Japan
United Kingdom
China
