Antibodies

Jump to Filters
View as table Download
Neurokinin B (TAC3) Rabbit Polyclonal Antibody
TA346470

USD 475.00

5 Days

Rabbit Polyclonal Anti-TAC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAC3 antibody: synthetic peptide directed towards the middle region of human TAC3. Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
Neurokinin B (TAC3) Rabbit Polyclonal Antibody
TA382266

USD 220.00

3 Weeks

TAC3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-121 of human TAC3 (NP_037383.1).
Modifications Unmodified