UGP2 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Uridine-5’-diphosphoglucose Pyrophosphorylase isolated and purified from Bovine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
UGP2 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Uridine-5’-diphosphoglucose Pyrophosphorylase isolated and purified from Bovine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-UGP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN |
Rabbit Polyclonal Anti-UGP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UGP2 |
UGP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UGP2 |
Germany
Japan
United Kingdom
China