Antibodies

Jump to Filters
View as table Download
ZNF322A (ZNF322) Rabbit Polyclonal Antibody
TA345393

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF322A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF322A antibody: synthetic peptide directed towards the C terminal of human ZNF322A. Synthetic peptide located within the following region: YTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
ZNF322A (ZNF322) Rabbit Polyclonal Antibody
TA341393

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF322A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF322A antibody: synthetic peptide directed towards the N terminal of human ZNF322A. Synthetic peptide located within the following region: RTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHL