Antibodies

View as table Download

Contactin 1 (CNTN1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 641~671 amino acids from the Central region of human CNTN1

Rabbit Polyclonal Anti-CNTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the middle region of human CNTN1. Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW

Rabbit Polyclonal Anti-CNTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the N terminal of human CNTN1. Synthetic peptide located within the following region: NGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL