Antibodies

Jump to Filters
View as table Download
SHC3 Rabbit Polyclonal Antibody
TA345002

USD 475.00

5 Days

Rabbit Polyclonal Anti-SHC3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHC3 antibody: synthetic peptide directed towards the middle region of human SHC3. Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST
SHC3 Rabbit Polyclonal Antibody
TA326108

USD 345.00

In Stock

Rabbit polyclonal SHC3 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SHC3.