Rabbit polyclonal FA7 (light chain, Cleaved-Arg212) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human FA7. |
Rabbit polyclonal FA7 (light chain, Cleaved-Arg212) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human FA7. |
Factor VII (F7) (209-444) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 209 and 444 of Factor VII |
Rabbit polyclonal antibody to Factor VII (coagulation factor VII (serum prothrombin conversion accelerator))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 209 and 466 of Factor VII (Uniprot ID#P08709) |
Rabbit Polyclonal Anti-F7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F7 antibody: synthetic peptide directed towards the C terminal of human F7. Synthetic peptide located within the following region: AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN |
Rabbit Polyclonal Anti-F7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F7 antibody: synthetic peptide directed towards the middle region of human F7. Synthetic peptide located within the following region: RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG |
Anti-F7 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human coagulation factor VII (serum prothrombin conversion accelerator) |
Anti-F7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human coagulation factor VII (serum prothrombin conversion accelerator) |