Antibodies

View as table Download

Rabbit Polyclonal Anti-EDAR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDAR antibody: synthetic peptide directed towards the middle region of human EDAR. Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV

Anti-EDAR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor

Anti-EDAR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor