Rabbit Polyclonal Anti-PIWIL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL2 antibody: synthetic peptide directed towards the N terminal of human PIWIL2. Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM |
Rabbit Polyclonal PIWI-L2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PIWI-L2 antibody was raised against a 14 amino acid synthetic peptide near the center of human PIWI-L2. |
Anti-PIWIL2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 107-120 amino acids of human piwi-like 2 (Drosophila) |
Germany
Japan
United Kingdom
China
