Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP6V0D1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: KLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQ

Rabbit Polyclonal Anti-ATP6V0D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: GGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPE