Rabbit Polyclonal Anti-FLOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the middle region of Human FLOT1. Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY |
Rabbit Polyclonal Anti-FLOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the C-terminal region of Human FLOT1. Synthetic peptide located within the following region: QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER |
Germany
Japan
United Kingdom
China
