Rabbit Polyclonal Anti-LIAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIAS antibody: synthetic peptide directed towards the C terminal of human LIAS. Synthetic peptide located within the following region: EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK |
Rabbit Polyclonal Anti-LIAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIAS antibody: synthetic peptide directed towards the N terminal of human LIAS. Synthetic peptide located within the following region: LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG |
Rabbit polyclonal antibody to Lipoic acid synthetase (lipoic acid synthetase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 54 and 258 of Lipoic acid synthetase (Uniprot ID#O43766) |
Germany
Japan
United Kingdom
China